(data stored in ACNUC7421 zone)

EMBL: CP001622.PE485

CP001622.PE485       Location/Qualifiers
FT   CDS             complement(513711..514706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0491"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   met:M446_1258 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54797"
FT                   /db_xref="GOA:C6B2H7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H7"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACS54797.1"
FT                   /translation="MSVQSTMKALLAEAPNSPLRIADISKPVPGEGQVLVRIKASGVNP
FT                   LDLKIRAGNAAHARHPLPAIVGIDMAGVVEEVGTGVSGFRRGDAVYGMTGGVGGIQGSL
FT                   AEFAAVDAALLAPKPQNLSMREAAALPLISITAWEGLVDRAGVKAGQKVLVIGGGGVGH
FT                   IVAQIAKAAGAEVYVVDGTSKADYLAGLGATPIDRDAETVETYVARHTGGKGFELVYDT
FT                   VGGQGLDTAFRAVSQFGHVVSCLGWGSHALAPLSFKAATYSGVFTLLPLLTGEGRAHHG
FT                   EIMREMTKLAEAGKVMPKLDPRRFTLADTDEAHRLIENRQADGKLVVEID"
     MSVQSTMKAL LAEAPNSPLR IADISKPVPG EGQVLVRIKA SGVNPLDLKI RAGNAAHARH        60
     PLPAIVGIDM AGVVEEVGTG VSGFRRGDAV YGMTGGVGGI QGSLAEFAAV DAALLAPKPQ       120
     NLSMREAAAL PLISITAWEG LVDRAGVKAG QKVLVIGGGG VGHIVAQIAK AAGAEVYVVD       180
     GTSKADYLAG LGATPIDRDA ETVETYVARH TGGKGFELVY DTVGGQGLDT AFRAVSQFGH       240
     VVSCLGWGSH ALAPLSFKAA TYSGVFTLLP LLTGEGRAHH GEIMREMTKL AEAGKVMPKL       300
     DPRRFTLADT DEAHRLIENR QADGKLVVEI D                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page