(data stored in ACNUC7421 zone)

EMBL: CP001622.PE486

CP001622.PE486       Location/Qualifiers
FT   CDS             514845..515696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0492"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mms:mma_1919 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54798"
FT                   /db_xref="GOA:C6B2H8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54798.1"
FT                   /translation="MEWSDLKLFLAIARFGTLGAAARRLGLTQPTMGRRLRALEASLGQ
FT                   TLFQRTTDGFVLTDEGAAVFAGAERIEEEALAMERSLAGGSRQLDGLLRLSSSDWFGAH
FT                   VLSPVLAEFSQVHPKVVVELLTDSRLLSLSRREADLVFRIQPFTEAEIVSRKLIRIEYG
FT                   LYISRGAPHPEAGDGAGARLVTMDEAFGEMPDVGWLRRLLPQADIVTRSNSRDVQAALC
FT                   ANGAGLAVLPRPLGDSLAAIELVDLGEPPPGRDTWVGYHRDMKRLARLRALLDLVIERL
FT                   AR"
     MEWSDLKLFL AIARFGTLGA AARRLGLTQP TMGRRLRALE ASLGQTLFQR TTDGFVLTDE        60
     GAAVFAGAER IEEEALAMER SLAGGSRQLD GLLRLSSSDW FGAHVLSPVL AEFSQVHPKV       120
     VVELLTDSRL LSLSRREADL VFRIQPFTEA EIVSRKLIRI EYGLYISRGA PHPEAGDGAG       180
     ARLVTMDEAF GEMPDVGWLR RLLPQADIVT RSNSRDVQAA LCANGAGLAV LPRPLGDSLA       240
     AIELVDLGEP PPGRDTWVGY HRDMKRLARL RALLDLVIER LAR                         283
//

If you have problems or comments...

PBIL Back to PBIL home page