(data stored in ACNUC7421 zone)

EMBL: CP001622.PE487

CP001622.PE487       Location/Qualifiers
FT   CDS             complement(515710..516606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0493"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_CH00807 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54799"
FT                   /db_xref="GOA:C6B2H9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54799.1"
FT                   /translation="MTNLGDLEIFAKVVSTGSMSLAGRALGFSPAVVSKRIKRLEDRLG
FT                   TRLLQRTTRQISLTEAGQGFYDRVLGILAGLEEAEFYISGRSAQMHGTLKISAPTSFGR
FT                   MHIAPHLKDFMEAHPELAINLVLTDEFSDIVGGGFDLAIRIAELTDSSLVARRLAPVRR
FT                   LLCASPDYLASHGEPKHIDELKRHRCLPAHNNDTWRLNGPDGALSLRPEGLLVTNSSEV
FT                   IREAVIAGLGIALRSTWDIGEELKAGRLVQVLPAYESSHNVALSAVYPSRQFLPAKVRL
FT                   FIDYLAELYGPVPYWER"
     MTNLGDLEIF AKVVSTGSMS LAGRALGFSP AVVSKRIKRL EDRLGTRLLQ RTTRQISLTE        60
     AGQGFYDRVL GILAGLEEAE FYISGRSAQM HGTLKISAPT SFGRMHIAPH LKDFMEAHPE       120
     LAINLVLTDE FSDIVGGGFD LAIRIAELTD SSLVARRLAP VRRLLCASPD YLASHGEPKH       180
     IDELKRHRCL PAHNNDTWRL NGPDGALSLR PEGLLVTNSS EVIREAVIAG LGIALRSTWD       240
     IGEELKAGRL VQVLPAYESS HNVALSAVYP SRQFLPAKVR LFIDYLAELY GPVPYWER         298
//

If you have problems or comments...

PBIL Back to PBIL home page