(data stored in ACNUC7421 zone)

EMBL: CP001622.PE488

CP001622.PE488       Location/Qualifiers
FT   CDS             516766..518205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0494"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ret:RHE_CH00808 glycolate oxidase subunit D protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54800"
FT                   /db_xref="GOA:C6B2I0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I0"
FT                   /inference="protein motif:PRIAM:1.1.2.4"
FT                   /protein_id="ACS54800.1"
FT                   /translation="MSDAISFLEPRADVLARRAQIVADLTDLLPLECLVHEARELVPFE
FT                   TDAFVSYRRLPLAVALPRTTAEVSAVMRYCNRYGIPVVPRGAGTSLSGGAIPQEDAVVL
FT                   GLSKMNSILEIDLPNRVAVVQAGVTNLNISESVSADGFFYAPDPSSQLACTIGGNIGMN
FT                   SGGAHCLKYGVTTNNLLGVRMVLVDGTVIELGGKALDAAGYDLLGLVCGHEGQLGIVTE
FT                   ATVRLIAKPEGARPVLFGFERSEEAGACVADVIAAGIIPVAIEFMDKPAIEICEAFAHA
FT                   GYPLDVGALLIVEVEGSEAEMDAALKDIVEIARRHAVKTVRECQSATEAALIWKGRKSA
FT                   FGATGRIADYICMDGTVPLSQLSYVLQRTAEIVDHYGLRVANVFHAGDGNMHPLILFNA
FT                   NDPEDAARAEAAGNDILRLCVDAGGCLTGEHGVGIEKRDLMRHQYSEVDLTQQMAARAA
FT                   FDPGWLLNPSKVFPLEGRPAA"
     MSDAISFLEP RADVLARRAQ IVADLTDLLP LECLVHEARE LVPFETDAFV SYRRLPLAVA        60
     LPRTTAEVSA VMRYCNRYGI PVVPRGAGTS LSGGAIPQED AVVLGLSKMN SILEIDLPNR       120
     VAVVQAGVTN LNISESVSAD GFFYAPDPSS QLACTIGGNI GMNSGGAHCL KYGVTTNNLL       180
     GVRMVLVDGT VIELGGKALD AAGYDLLGLV CGHEGQLGIV TEATVRLIAK PEGARPVLFG       240
     FERSEEAGAC VADVIAAGII PVAIEFMDKP AIEICEAFAH AGYPLDVGAL LIVEVEGSEA       300
     EMDAALKDIV EIARRHAVKT VRECQSATEA ALIWKGRKSA FGATGRIADY ICMDGTVPLS       360
     QLSYVLQRTA EIVDHYGLRV ANVFHAGDGN MHPLILFNAN DPEDAARAEA AGNDILRLCV       420
     DAGGCLTGEH GVGIEKRDLM RHQYSEVDLT QQMAARAAFD PGWLLNPSKV FPLEGRPAA        479
//

If you have problems or comments...

PBIL Back to PBIL home page