(data stored in ACNUC7421 zone)

EMBL: CP001622.PE489

CP001622.PE489       Location/Qualifiers
FT   CDS             518202..519401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0495"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000894 glycolate oxidase protein, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54801"
FT                   /db_xref="GOA:C6B2I1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I1"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACS54801.1"
FT                   /translation="MIDLTPTSEEEAAVIVRAHAESGRPLAICGGNSRSGFGNTVAAEG
FT                   RLRSTGLSGIVAYNPGEMVMTVRSGTSLAEVEAALQESGQMLAFEPMDHRPVMGTSGEP
FT                   TIGGVFAANVSGPRRLIAGAARDSLLGVRFVNGKGEIIKAGGRVMKNVTGLDLAKLVAG
FT                   SHGTLAFLTEVTFRVPPRPKTERTVLLSGLNDAEAANAMAAAMALPVEVSGAAHLPLTV
FT                   TWKFLAGKLPEGEATALRIEGLPGSVDVRIEKLAAAMSGFATVTRLEQPESQKLWQEIR
FT                   DVLPYADGSMRPIWRVSVAPGTGPQLVAALRLEAGVDAFYDWQGGLVWMRMEAGPEAEL
FT                   VRRYIKALGGGHATLIRASGEARATTAAFHPEPEAVTMLSQRVKEKFDPAGIFNPGKMG
FT                   "
     MIDLTPTSEE EAAVIVRAHA ESGRPLAICG GNSRSGFGNT VAAEGRLRST GLSGIVAYNP        60
     GEMVMTVRSG TSLAEVEAAL QESGQMLAFE PMDHRPVMGT SGEPTIGGVF AANVSGPRRL       120
     IAGAARDSLL GVRFVNGKGE IIKAGGRVMK NVTGLDLAKL VAGSHGTLAF LTEVTFRVPP       180
     RPKTERTVLL SGLNDAEAAN AMAAAMALPV EVSGAAHLPL TVTWKFLAGK LPEGEATALR       240
     IEGLPGSVDV RIEKLAAAMS GFATVTRLEQ PESQKLWQEI RDVLPYADGS MRPIWRVSVA       300
     PGTGPQLVAA LRLEAGVDAF YDWQGGLVWM RMEAGPEAEL VRRYIKALGG GHATLIRASG       360
     EARATTAAFH PEPEAVTMLS QRVKEKFDPA GIFNPGKMG                              399
//

If you have problems or comments...

PBIL Back to PBIL home page