(data stored in ACNUC7421 zone)

EMBL: CP001622.PE49

CP001622.PE49        Location/Qualifiers
FT   CDS             complement(50340..51215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54361"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000432"
FT                   /protein_id="ACS54361.1"
FT                   /translation="MSAIDILNRDTTAEAAPPSTAVQKDGDILGRIGNLETRLARTARE
FT                   IDAAQAVRYRVFVDEMKAQLPLDAMRRQRDVDAYDAVCDHLLVLDRSIEGDPEDQIVGT
FT                   YRLLRQDVAIANGGFYSASEFEIEGLIAKHPDKRFMELGRSCVLPEYRTKRTVELLWQG
FT                   NWAYALKHGVSAMFGCASFPGVYLESHALALSFLYHNVLAKNEWAIGALPHLARNMDLM
FT                   PVEAINPKRALMALPPLIKGYLRLGAMVGSSAVIDHAFNTTDVLIVLPISSISDRYLNY
FT                   YGADAGRFAS"
     MSAIDILNRD TTAEAAPPST AVQKDGDILG RIGNLETRLA RTAREIDAAQ AVRYRVFVDE        60
     MKAQLPLDAM RRQRDVDAYD AVCDHLLVLD RSIEGDPEDQ IVGTYRLLRQ DVAIANGGFY       120
     SASEFEIEGL IAKHPDKRFM ELGRSCVLPE YRTKRTVELL WQGNWAYALK HGVSAMFGCA       180
     SFPGVYLESH ALALSFLYHN VLAKNEWAIG ALPHLARNMD LMPVEAINPK RALMALPPLI       240
     KGYLRLGAMV GSSAVIDHAF NTTDVLIVLP ISSISDRYLN YYGADAGRFA S                291
//

If you have problems or comments...

PBIL Back to PBIL home page