(data stored in ACNUC7421 zone)

EMBL: CP001622.PE490

CP001622.PE490       Location/Qualifiers
FT   CDS             519653..520963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0497"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: ret:RHE_CH00810
FT                   glycolate oxidase subunit F protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54802"
FT                   /db_xref="GOA:C6B2I2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I2"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACS54802.1"
FT                   /translation="MQTNFTPTQLLDPDVAESEQILRKCVHCGFCTATCPTYVTLGNEL
FT                   DSPRGRIYLIKDMLENGRPADTEVVTHIDRCLSCLACVTTCPSGVDYMHLVDHARAHIE
FT                   KTYKRPFMNRLTRAILAAVLPYPGRFRLALNLARLGRPFAGLMRGGALKPFAAMLALAP
FT                   RRIPAASDFAKPGTHRPETERRGRVAILSGCAQPVLDPGINAAAIRLLTRLGVEVVVPE
FT                   SEVCCGSLVHHMGRAEQALESARANVDIWTREIEGQGLDAIIITASGCGTTIKDYGHML
FT                   RLDPAYAAKAARVSALAKDVTEYLATLDLPAHMPKGITVAYHSACSMQHGQRITLAPKQ
FT                   LLKAAGFTVRDPAEGHFCCGSAGIYNIMQPEISAVLKARKVKNLEATKADIIATGNIGC
FT                   ITQIATGTGIPILHTVELLDWAYGGAVPEKLTGLPLG"
     MQTNFTPTQL LDPDVAESEQ ILRKCVHCGF CTATCPTYVT LGNELDSPRG RIYLIKDMLE        60
     NGRPADTEVV THIDRCLSCL ACVTTCPSGV DYMHLVDHAR AHIEKTYKRP FMNRLTRAIL       120
     AAVLPYPGRF RLALNLARLG RPFAGLMRGG ALKPFAAMLA LAPRRIPAAS DFAKPGTHRP       180
     ETERRGRVAI LSGCAQPVLD PGINAAAIRL LTRLGVEVVV PESEVCCGSL VHHMGRAEQA       240
     LESARANVDI WTREIEGQGL DAIIITASGC GTTIKDYGHM LRLDPAYAAK AARVSALAKD       300
     VTEYLATLDL PAHMPKGITV AYHSACSMQH GQRITLAPKQ LLKAAGFTVR DPAEGHFCCG       360
     SAGIYNIMQP EISAVLKARK VKNLEATKAD IIATGNIGCI TQIATGTGIP ILHTVELLDW       420
     AYGGAVPEKL TGLPLG                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page