(data stored in ACNUC7421 zone)

EMBL: CP001622.PE491

CP001622.PE491       Location/Qualifiers
FT   CDS             521006..521446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54803"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000896"
FT                   /protein_id="ACS54803.1"
FT                   /translation="MWRGMIVLAGLLGAAGTAHANSRYFCSADDKEARFTLESGFESAA
FT                   GHKLNHFRGALIVKDPAQEAVFGKRVFESQHLTNHWSRNGELLMEVFDGGEDDTGGATL
FT                   DLVVIAGERGKPAANFSGSYSLTIEGGEKPYAVEGKVSCGTK"
     MWRGMIVLAG LLGAAGTAHA NSRYFCSADD KEARFTLESG FESAAGHKLN HFRGALIVKD        60
     PAQEAVFGKR VFESQHLTNH WSRNGELLME VFDGGEDDTG GATLDLVVIA GERGKPAANF       120
     SGSYSLTIEG GEKPYAVEGK VSCGTK                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page