(data stored in ACNUC7421 zone)

EMBL: CP001622.PE492

CP001622.PE492       Location/Qualifiers
FT   CDS             complement(521474..522148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0499"
FT                   /product="lipid A oxidase (involved in formation of
FT                   2-aminogluconate) protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000897 lipid A oxidase
FT                   (involved in formation of 2-aminogluconate) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54804"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000897"
FT                   /protein_id="ACS54804.1"
FT                   /translation="MTSALRSSASLLAGIAFLTICSAVSASAEDLQFSIYGGYQTAPHS
FT                   GVDLSDGTHFTAGWEGKSFGSPPYYGGRVTWWLENFNKPNWGISLDYTHDKVYADDDTL
FT                   AKAGWSHFEFTDGLNLLTVNGLYRFQDPTRRWTPYLGAGIGVNIPHVEVIRPEGKTWAY
FT                   EFGGVTLQAQAGVDFKVTERWSTFVEYKGTYSRVDVPIDSGVDLKTNIFTNAVNVGVSF
FT                   HW"
     MTSALRSSAS LLAGIAFLTI CSAVSASAED LQFSIYGGYQ TAPHSGVDLS DGTHFTAGWE        60
     GKSFGSPPYY GGRVTWWLEN FNKPNWGISL DYTHDKVYAD DDTLAKAGWS HFEFTDGLNL       120
     LTVNGLYRFQ DPTRRWTPYL GAGIGVNIPH VEVIRPEGKT WAYEFGGVTL QAQAGVDFKV       180
     TERWSTFVEY KGTYSRVDVP IDSGVDLKTN IFTNAVNVGV SFHW                        224
//

If you have problems or comments...

PBIL Back to PBIL home page