(data stored in ACNUC7421 zone)

EMBL: CP001622.PE493

CP001622.PE493       Location/Qualifiers
FT   CDS             complement(522269..522961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0500"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   ret:RHE_CH00813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54805"
FT                   /db_xref="GOA:C6B2I5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I5"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACS54805.1"
FT                   /translation="MIKLMPGLAAAGLVLSLMSTSAFAAPAGSAPDNARAPAQIVRVAQ
FT                   MPKYVKPQFKRKKVRLATTEAAGTVIIDTNNKYLYLVEGNNRATRYGIGVGRDGFGWSG
FT                   VVKIGRKAEWPGWTPPAEMRRREAAKGHMIPAFQEGGEDNPLGARAMYLYQGGRDTIFR
FT                   IHGTNQPWTIGLNMSSGCIRMMNEDVSHLYDRAPVGTKVIVIGPGNRQGKVAFEDRGID
FT                   VLRTMFGG"
     MIKLMPGLAA AGLVLSLMST SAFAAPAGSA PDNARAPAQI VRVAQMPKYV KPQFKRKKVR        60
     LATTEAAGTV IIDTNNKYLY LVEGNNRATR YGIGVGRDGF GWSGVVKIGR KAEWPGWTPP       120
     AEMRRREAAK GHMIPAFQEG GEDNPLGARA MYLYQGGRDT IFRIHGTNQP WTIGLNMSSG       180
     CIRMMNEDVS HLYDRAPVGT KVIVIGPGNR QGKVAFEDRG IDVLRTMFGG                  230
//

If you have problems or comments...

PBIL Back to PBIL home page