(data stored in ACNUC7421 zone)

EMBL: CP001622.PE495

CP001622.PE495       Location/Qualifiers
FT   CDS             524200..524829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0502"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: methyladenine glycosylase; KEGG:
FT                   rec:RHECIAT_CH0000900 DNA-3-methyladenine glycosylase I
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54807"
FT                   /db_xref="GOA:C6B2I7"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I7"
FT                   /inference="protein motif:PRIAM:3.2.2.20"
FT                   /protein_id="ACS54807.1"
FT                   /translation="MSATGIIIGEDGRSRCHWHANLPDYLRYHDEEWGRPVTDDIRLFE
FT                   KICLEGFQSGLSWLTILRKRENFRAAFSGFDFDKVALFGEEDVARCLGDAGIIRHRGKI
FT                   VSTINNAKRAIELRGEFGSLAHYFWRYEPGHNERPAVVDREHIVANPTTPTSVVISKDL
FT                   KKRGWTFVGPTTVYAFMQAMGLVNDHLEGCFCRPEVEAMRTALVRP"
     MSATGIIIGE DGRSRCHWHA NLPDYLRYHD EEWGRPVTDD IRLFEKICLE GFQSGLSWLT        60
     ILRKRENFRA AFSGFDFDKV ALFGEEDVAR CLGDAGIIRH RGKIVSTINN AKRAIELRGE       120
     FGSLAHYFWR YEPGHNERPA VVDREHIVAN PTTPTSVVIS KDLKKRGWTF VGPTTVYAFM       180
     QAMGLVNDHL EGCFCRPEVE AMRTALVRP                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page