(data stored in ACNUC7421 zone)

EMBL: CP001622.PE496

CP001622.PE496       Location/Qualifiers
FT   CDS             524826..525332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54808"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000901"
FT                   /protein_id="ACS54808.1"
FT                   /translation="MKDHAVRTLIAAAALFLLTVSAMAQTPQLDPGEKLEKLQFPAVTM
FT                   QLKGWTKFGNGHVYTLPVRAGQHMKISFSTKSKFAFLAIFDLSKPDDEAFFGTDEDGMS
FT                   FETTIKENATWLLRPYYSKVSPRRGLGAPFSILIEPLAAAPQQPKPPAEPERPSLFPKA
FT                   PPKPQ"
     MKDHAVRTLI AAAALFLLTV SAMAQTPQLD PGEKLEKLQF PAVTMQLKGW TKFGNGHVYT        60
     LPVRAGQHMK ISFSTKSKFA FLAIFDLSKP DDEAFFGTDE DGMSFETTIK ENATWLLRPY       120
     YSKVSPRRGL GAPFSILIEP LAAAPQQPKP PAEPERPSLF PKAPPKPQ                    168
//

If you have problems or comments...

PBIL Back to PBIL home page