(data stored in ACNUC7421 zone)

EMBL: CP001622.PE497

CP001622.PE497       Location/Qualifiers
FT   CDS             complement(525352..526056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0504"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: rec:RHECIAT_CH0000902 putative hydrolase
FT                   protein, HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54809"
FT                   /db_xref="GOA:C6B2I9"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I9"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACS54809.1"
FT                   /translation="MTTRPLTTIGFDADDTLWQNEQYYRLTEAHFTGLLADFAEGPKIS
FT                   ERLLEAEKRNLRHYGFGIKGFTLSMIETAIEITEGKIPAGVIAKILDTGRELLSHPVET
FT                   MPHVRDTLEALAGKYLLVMITKGDLFDQERKLAQSGLGDFFDAVEIVSDKTAVTYRRIF
FT                   AKVGDGPERAMMVGNSLKSDIVPAIAAGSYGVFVPHELTWVLEHVDEPKEAPRFRKIDH
FT                   LGELRDLIDRLG"
     MTTRPLTTIG FDADDTLWQN EQYYRLTEAH FTGLLADFAE GPKISERLLE AEKRNLRHYG        60
     FGIKGFTLSM IETAIEITEG KIPAGVIAKI LDTGRELLSH PVETMPHVRD TLEALAGKYL       120
     LVMITKGDLF DQERKLAQSG LGDFFDAVEI VSDKTAVTYR RIFAKVGDGP ERAMMVGNSL       180
     KSDIVPAIAA GSYGVFVPHE LTWVLEHVDE PKEAPRFRKI DHLGELRDLI DRLG             234
//

If you have problems or comments...

PBIL Back to PBIL home page