(data stored in ACNUC7421 zone)

EMBL: CP001622.PE498

CP001622.PE498       Location/Qualifiers
FT   CDS             526294..527343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0505"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ret:RHE_CH00818
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54810"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J0"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS54810.1"
FT                   /translation="MRYNQLGNTGLFVSEICLGTMTFGEAKQGTAWGAIADVDQNAADR
FT                   IVERSLASGVNFIDTADVYSTGESERLLGQALKNLDIQRKDVVIATKVYGVMGDKPNDR
FT                   GASRGHIMDSVEASLKRLQTDHIDLYQIHATDTVTPIEETLRAFDDLVSRGLVRYIGVS
FT                   NWQAWRISKALGLSERRGFARFETVQAYYSIAGRDLERDIVPMMQEEKLGLMVWSPLAG
FT                   GLLSGKYGPGAPGNGEGRRASFDFPPVDKDKAWACVAVMREVAEKHGVSVATVALAYIL
FT                   AKPFVTTVIIGAKRVDQLDQNLAAVKLKLDEGDIKKLDEVSALAPEYPGWMLARQGAGR
FT                   RPADFEPKD"
     MRYNQLGNTG LFVSEICLGT MTFGEAKQGT AWGAIADVDQ NAADRIVERS LASGVNFIDT        60
     ADVYSTGESE RLLGQALKNL DIQRKDVVIA TKVYGVMGDK PNDRGASRGH IMDSVEASLK       120
     RLQTDHIDLY QIHATDTVTP IEETLRAFDD LVSRGLVRYI GVSNWQAWRI SKALGLSERR       180
     GFARFETVQA YYSIAGRDLE RDIVPMMQEE KLGLMVWSPL AGGLLSGKYG PGAPGNGEGR       240
     RASFDFPPVD KDKAWACVAV MREVAEKHGV SVATVALAYI LAKPFVTTVI IGAKRVDQLD       300
     QNLAAVKLKL DEGDIKKLDE VSALAPEYPG WMLARQGAGR RPADFEPKD                   349
//

If you have problems or comments...

PBIL Back to PBIL home page