(data stored in ACNUC7421 zone)

EMBL: CP001622.PE5

CP001622.PE5         Location/Qualifiers
FT   CDS             complement(4750..5166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0005"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00362
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54317"
FT                   /db_xref="GOA:C6AY93"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY93"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54317.1"
FT                   /translation="MLEGMLETALYARDLDQAETFYEDVLGLEKIARAANRHVFFRCGP
FT                   GVLLIFNPEETVKPPAPEALQVPPHGTTGQGHACFRVSGRNIDAMAERLTAAGVAIESE
FT                   VRWPKGGRSIYFRDPAGNSLECAEAKIWGIEQDI"
     MLEGMLETAL YARDLDQAET FYEDVLGLEK IARAANRHVF FRCGPGVLLI FNPEETVKPP        60
     APEALQVPPH GTTGQGHACF RVSGRNIDAM AERLTAAGVA IESEVRWPKG GRSIYFRDPA       120
     GNSLECAEAK IWGIEQDI                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page