(data stored in ACNUC7421 zone)

EMBL: CP001622.PE50

CP001622.PE50        Location/Qualifiers
FT   CDS             complement(51324..53606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0051"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; KEGG: rec:RHECIAT_CH0000433 putative two-component
FT                   sensor histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54362"
FT                   /db_xref="GOA:C6AYD8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54362.1"
FT                   /translation="MQNLGQLQERLSAAFGGPAAKPHEKRMEAVFARPNAPAPRGADDR
FT                   QDGPAPTRRLLFYWLGGAGLLAATILMLLAHAGDPLLLSGGLVVLGLAVIASYALLMVR
FT                   SRKAGQRPGQSMPDENGGAKLFADVHDVLGDITVSRTMDRRIISANDTFRRLTGRLRPE
FT                   GKTCEEIGLAFRPGPIPHCYDVEISTPEGQRIFLWRDVVTRDPANGRLLLQSVARDVTD
FT                   ERLIAQGREEARQKAEYNSAAKSRLLATVSHEVRTPLSGILGMTHLIAETRLTQEQQNY
FT                   LANIRQSGHALTQLVEDLLDFSTIEVGRFALHPRSESLRKLLESVVEMLAHRAHEKGIE
FT                   IGATVSSDVPENMSFDPARLRQVLFNVIGNAVKFTQVGGVFIRVSLDDDDLSITVTDSG
FT                   PGMTTEEQARVFGEFEQGGSVVDKSSGTGLGLAISARIMREFNGALTVASEKGRGSEFT
FT                   ICFPVDIDSERPDRRNTLLSGNSVVLLAPAGAARTAIAETITTLGGLCHLVGDGETARA
FT                   TLLELAKGGRRPTDIIIDHRMSAEFSAHLADRAEIAALGLRKVLLVNPEERSAHPLDLF
FT                   DAWLIRPLREQSLIDVLRGRMRGMEKRDALNDNQPGFGLSVAETLVAASGLSILLGEDD
FT                   PINAMLVRVVLEKGGHKVRHVEDFETLLDYALCEANARPDIIISDLSMPGGNGIDMLGR
FT                   LRGHERRLDLASVPVIVLTADKSDESRRQVLLNGANRVMVKPVDPVRLLTEVQAVAALS
FT                   ARRAEAR"
     MQNLGQLQER LSAAFGGPAA KPHEKRMEAV FARPNAPAPR GADDRQDGPA PTRRLLFYWL        60
     GGAGLLAATI LMLLAHAGDP LLLSGGLVVL GLAVIASYAL LMVRSRKAGQ RPGQSMPDEN       120
     GGAKLFADVH DVLGDITVSR TMDRRIISAN DTFRRLTGRL RPEGKTCEEI GLAFRPGPIP       180
     HCYDVEISTP EGQRIFLWRD VVTRDPANGR LLLQSVARDV TDERLIAQGR EEARQKAEYN       240
     SAAKSRLLAT VSHEVRTPLS GILGMTHLIA ETRLTQEQQN YLANIRQSGH ALTQLVEDLL       300
     DFSTIEVGRF ALHPRSESLR KLLESVVEML AHRAHEKGIE IGATVSSDVP ENMSFDPARL       360
     RQVLFNVIGN AVKFTQVGGV FIRVSLDDDD LSITVTDSGP GMTTEEQARV FGEFEQGGSV       420
     VDKSSGTGLG LAISARIMRE FNGALTVASE KGRGSEFTIC FPVDIDSERP DRRNTLLSGN       480
     SVVLLAPAGA ARTAIAETIT TLGGLCHLVG DGETARATLL ELAKGGRRPT DIIIDHRMSA       540
     EFSAHLADRA EIAALGLRKV LLVNPEERSA HPLDLFDAWL IRPLREQSLI DVLRGRMRGM       600
     EKRDALNDNQ PGFGLSVAET LVAASGLSIL LGEDDPINAM LVRVVLEKGG HKVRHVEDFE       660
     TLLDYALCEA NARPDIIISD LSMPGGNGID MLGRLRGHER RLDLASVPVI VLTADKSDES       720
     RRQVLLNGAN RVMVKPVDPV RLLTEVQAVA ALSARRAEAR                             760
//

If you have problems or comments...

PBIL Back to PBIL home page