(data stored in ACNUC7421 zone)

EMBL: CP001622.PE500

CP001622.PE500       Location/Qualifiers
FT   CDS             complement(527843..528208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54812"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000905"
FT                   /protein_id="ACS54812.1"
FT                   /translation="MRMLALITMFLGWLVYSAMSAWAGCPTCASMNAPVVVENGMHHQM
FT                   AGMDRHEAADTADPLKDPCATGNSAHMPLCVACLLLPATVTVMDGGKSIFGYPAPALAR
FT                   ALDDDKPTPQPPPPRLS"
     MRMLALITMF LGWLVYSAMS AWAGCPTCAS MNAPVVVENG MHHQMAGMDR HEAADTADPL        60
     KDPCATGNSA HMPLCVACLL LPATVTVMDG GKSIFGYPAP ALARALDDDK PTPQPPPPRL       120
     S                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page