(data stored in ACNUC7421 zone)

EMBL: CP001622.PE501

CP001622.PE501       Location/Qualifiers
FT   CDS             complement(528266..529021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54813"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000906"
FT                   /protein_id="ACS54813.1"
FT                   /translation="MITEALLYAATLPLTGKPHRKFIRYSVNLWSRAGRCAADWAEHEE
FT                   MSRKAILAATADLRQKRTAVVLGSGLLRDVPIEVLARDFDTVVLVDLVHLASVRLWLSA
FT                   KFHRNVQLIERDLSGYDDLAAGREPEPLGFLRAVPYLDLVVSANLLSQIGRGVKRRHGA
FT                   EAGRMPEDTVERLIAAHLTGLSGLPCRNCLVTDIAYAVIDRNGKTHEEADLLHGVLPPP
FT                   AKAAWTWPVAPLGEESKDYRIEHNVMAAW"
     MITEALLYAA TLPLTGKPHR KFIRYSVNLW SRAGRCAADW AEHEEMSRKA ILAATADLRQ        60
     KRTAVVLGSG LLRDVPIEVL ARDFDTVVLV DLVHLASVRL WLSAKFHRNV QLIERDLSGY       120
     DDLAAGREPE PLGFLRAVPY LDLVVSANLL SQIGRGVKRR HGAEAGRMPE DTVERLIAAH       180
     LTGLSGLPCR NCLVTDIAYA VIDRNGKTHE EADLLHGVLP PPAKAAWTWP VAPLGEESKD       240
     YRIEHNVMAA W                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page