(data stored in ACNUC7421 zone)

EMBL: CP001622.PE502

CP001622.PE502       Location/Qualifiers
FT   CDS             529158..530678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0509"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: rec:RHECIAT_CH0000907 histidyl-tRNA synthetase
FT                   protein; TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54814"
FT                   /db_xref="GOA:C6B2J4"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J4"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ACS54814.1"
FT                   /translation="MNDKQKKPQKLKARLPRGFVDRTAGDIRAVNEMTAKIREVYEHYG
FT                   FDPLETPLFEYTDALGKFLPDSDRPNEGVFSLQDDDEQWMSLRYDLTAPLARHVAENFN
FT                   EIQLPYRTYRAGYVFRNEKPGPGRFRQFMQFDADTVGAPGVQADAEMCMMMADTLEALG
FT                   IKRGDYLIRVNNRKVLDGVLEAIGLGGDDKAGQRLNVLRAIDKLDKFGPEGVALLLGPG
FT                   RKDESGDFTKGAGLDKEQIDKVLFFVGITDYAESVARLAELVAGTARGGEGVDELNFIG
FT                   ALVTSAGYGPDRIKIDPSVVRGLEYYTGPVYEAELTFDVTNEKGEKVVFGSVGGGGRYD
FT                   GLVSRFMGQPVPATGFSIGVSRLMTALKNLGKLGASEVIEPVLVTVMDGDVEAMGRYQK
FT                   MTQELRAAGIRAEMFQGNWKKFGNQLKYADRRGCPVAIIQGGDERATSVVQIKDLIEGK
FT                   RLSGEIEDNASWREARVAQETVPEADLVAKVREILAAQAEDRKRAANV"
     MNDKQKKPQK LKARLPRGFV DRTAGDIRAV NEMTAKIREV YEHYGFDPLE TPLFEYTDAL        60
     GKFLPDSDRP NEGVFSLQDD DEQWMSLRYD LTAPLARHVA ENFNEIQLPY RTYRAGYVFR       120
     NEKPGPGRFR QFMQFDADTV GAPGVQADAE MCMMMADTLE ALGIKRGDYL IRVNNRKVLD       180
     GVLEAIGLGG DDKAGQRLNV LRAIDKLDKF GPEGVALLLG PGRKDESGDF TKGAGLDKEQ       240
     IDKVLFFVGI TDYAESVARL AELVAGTARG GEGVDELNFI GALVTSAGYG PDRIKIDPSV       300
     VRGLEYYTGP VYEAELTFDV TNEKGEKVVF GSVGGGGRYD GLVSRFMGQP VPATGFSIGV       360
     SRLMTALKNL GKLGASEVIE PVLVTVMDGD VEAMGRYQKM TQELRAAGIR AEMFQGNWKK       420
     FGNQLKYADR RGCPVAIIQG GDERATSVVQ IKDLIEGKRL SGEIEDNASW REARVAQETV       480
     PEADLVAKVR EILAAQAEDR KRAANV                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page