(data stored in ACNUC7421 zone)

EMBL: CP001622.PE503

CP001622.PE503       Location/Qualifiers
FT   CDS             530721..531842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0510"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   ret:RHE_CH00822 ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54815"
FT                   /db_xref="GOA:C6B2J5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J5"
FT                   /inference="protein motif:PFAM:PF00587"
FT                   /protein_id="ACS54815.1"
FT                   /translation="MPLINLPEFANDLIAEFDARNAERIDTPVIQPAEPFLDIAGEDLR
FT                   RRIFMTESETGASLCLRPEFTIPVCLRHIETATGTPKRYAYLGEVFRQRRDGANEFYQA
FT                   GIEDLGDIDLSNADARAIGDATGILARLLPGRRLAVTLGDQAVFEAVVQALGLPLGWQK
FT                   RLIHAFGNMTQLEALLASLVSPQFVTGLDDDIARLVASDDEQALVAYLEREMQKTGYST
FT                   NAGRSALEIARRLKEKLILSETRLDDAAFRVLEEFLSLDVPLINASAALSGFADAAGLK
FT                   LGNALARFNGRVAALSNAGVDLSCLDYRAAFGRPLDYYTGLVFEVTVEGSTAVLAGGGR
FT                   FDRLLTFLGATDRIPAVGFSFWLDRIETERAAA"
     MPLINLPEFA NDLIAEFDAR NAERIDTPVI QPAEPFLDIA GEDLRRRIFM TESETGASLC        60
     LRPEFTIPVC LRHIETATGT PKRYAYLGEV FRQRRDGANE FYQAGIEDLG DIDLSNADAR       120
     AIGDATGILA RLLPGRRLAV TLGDQAVFEA VVQALGLPLG WQKRLIHAFG NMTQLEALLA       180
     SLVSPQFVTG LDDDIARLVA SDDEQALVAY LEREMQKTGY STNAGRSALE IARRLKEKLI       240
     LSETRLDDAA FRVLEEFLSL DVPLINASAA LSGFADAAGL KLGNALARFN GRVAALSNAG       300
     VDLSCLDYRA AFGRPLDYYT GLVFEVTVEG STAVLAGGGR FDRLLTFLGA TDRIPAVGFS       360
     FWLDRIETER AAA                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page