(data stored in ACNUC7421 zone)

EMBL: CP001622.PE504

CP001622.PE504       Location/Qualifiers
FT   CDS             531839..532534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0511"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: ret:RHE_CH00823 ATP phosphoribosyltransferase
FT                   catalytic subunit; TIGRFAM: ATP phosphoribosyltransferase;
FT                   PFAM: ATP phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54816"
FT                   /db_xref="GOA:C6B2J6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J6"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ACS54816.1"
FT                   /translation="MTITIALPSKGRMKEDASAIFERAGMTISAVGNDRSYRGRVEGWD
FT                   DVEIAFLSASEISREIGNGTVDFGVTGEDLMREGFAEVDKRVEFCARLGFGHADVVVAV
FT                   PEIWLDVDTMADLVDVAADFRARHSRRLAIATKYWRLTQQFFSSQHGIQLYRIVESLGA
FT                   TEGAPASGSADIIVDITSTGSTLRANHLKVLQDGVILHSQACLVRARKESHAGEPAVQA
FT                   IIDAVRAAL"
     MTITIALPSK GRMKEDASAI FERAGMTISA VGNDRSYRGR VEGWDDVEIA FLSASEISRE        60
     IGNGTVDFGV TGEDLMREGF AEVDKRVEFC ARLGFGHADV VVAVPEIWLD VDTMADLVDV       120
     AADFRARHSR RLAIATKYWR LTQQFFSSQH GIQLYRIVES LGATEGAPAS GSADIIVDIT       180
     STGSTLRANH LKVLQDGVIL HSQACLVRAR KESHAGEPAV QAIIDAVRAA L                231
//

If you have problems or comments...

PBIL Back to PBIL home page