(data stored in ACNUC7421 zone)

EMBL: CP001622.PE505

CP001622.PE505       Location/Qualifiers
FT   CDS             complement(532614..533030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0512"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: ret:RHE_CH00824
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54817"
FT                   /db_xref="GOA:C6B2J7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J7"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACS54817.1"
FT                   /translation="MSNNVIILIARILLSFMFILSGFMKLTDPAGTAGMIAGAGLPAAT
FT                   LLAYVAGLFELLAGLAVLTGLQVRIAGWLLAAFCVFTGIAFHLPYASGTELVNILNQIM
FT                   VMKNITLAGAYILLATVGAGAYSLDARRGAYATA"
     MSNNVIILIA RILLSFMFIL SGFMKLTDPA GTAGMIAGAG LPAATLLAYV AGLFELLAGL        60
     AVLTGLQVRI AGWLLAAFCV FTGIAFHLPY ASGTELVNIL NQIMVMKNIT LAGAYILLAT       120
     VGAGAYSLDA RRGAYATA                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page