(data stored in ACNUC7421 zone)

EMBL: CP001622.PE506

CP001622.PE506       Location/Qualifiers
FT   CDS             533345..534055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0513"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ret:RHE_CH00825 glutathione S-transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54818"
FT                   /db_xref="GOA:C6B2J8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J8"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACS54818.1"
FT                   /translation="MADLSAFPITTRWPAKNPDIIQLYSLQTPNGVKVSVALEELGLAY
FT                   EPHYISFAANDQKSPEFESLNPNGRIPAIIDPNGPDGKPIGLFESGAILLYLAEKTGKL
FT                   IPADAAGRYETIQWVFFQMAGIGPMFGQFGHFHKFAADKVANNSYPVERYRDESKRLLG
FT                   VLDDRLKGRQWIMGDQYTIADITTFTWVRGADIFYGGREVLEYAKFPAVSDWLERCIAR
FT                   PASARGLNIPVKPE"
     MADLSAFPIT TRWPAKNPDI IQLYSLQTPN GVKVSVALEE LGLAYEPHYI SFAANDQKSP        60
     EFESLNPNGR IPAIIDPNGP DGKPIGLFES GAILLYLAEK TGKLIPADAA GRYETIQWVF       120
     FQMAGIGPMF GQFGHFHKFA ADKVANNSYP VERYRDESKR LLGVLDDRLK GRQWIMGDQY       180
     TIADITTFTW VRGADIFYGG REVLEYAKFP AVSDWLERCI ARPASARGLN IPVKPE           236
//

If you have problems or comments...

PBIL Back to PBIL home page