(data stored in ACNUC7421 zone)

EMBL: CP001622.PE507

CP001622.PE507       Location/Qualifiers
FT   CDS             complement(534119..534565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54819"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000912"
FT                   /protein_id="ACS54819.1"
FT                   /translation="MFKIARANAAVPLTPGSFDDANQNHEMLAQFSVSEAWTGDFSSGM
FT                   LRLGEWSAMLHGLAARECGLLSLIRCYDAKDRSHILELFEQAATLCSSFCFSTTIIMPN
FT                   GLRQPLFCMGESNGLEQKYSGSMVGVFVFPRFKLEGTKQITSRR"
     MFKIARANAA VPLTPGSFDD ANQNHEMLAQ FSVSEAWTGD FSSGMLRLGE WSAMLHGLAA        60
     RECGLLSLIR CYDAKDRSHI LELFEQAATL CSSFCFSTTI IMPNGLRQPL FCMGESNGLE       120
     QKYSGSMVGV FVFPRFKLEG TKQITSRR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page