(data stored in ACNUC7421 zone)

EMBL: CP001622.PE508

CP001622.PE508       Location/Qualifiers
FT   CDS             complement(535298..536941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0515"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: ret:RHE_CH00828 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54820"
FT                   /db_xref="GOA:C6B2K0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K0"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACS54820.1"
FT                   /translation="MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFG
FT                   APRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGN
FT                   KAVAAGMNPMDLKRGIDLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIA
FT                   EAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILL
FT                   HEKKLSNLQSMLPVLEAVVQTGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKT
FT                   DIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDA
FT                   LNATRAAVQEGIVPGGGIALLRSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAG
FT                   DEASIVVGKVLDKNEDNYGYNAQTSEYGDMIAMGIVDPLKVVRTALQNAASVASLLITT
FT                   EAMIAELPKKESAGGGMPGGMGGMGGMDMM"
     MASKEIKFGR TAREKMLRGV DILADAVKVT LGPKGRNVII DKSFGAPRIT KDGVSVAKEI        60
     ELEDKFENMG AQMVREVASK TNDIAGDGTT TATVLAQAIV REGNKAVAAG MNPMDLKRGI       120
     DLAVADVVKD LQAKAKKIST SEEVAQVGTI SANGDKQVGL DIAEAMQKVG NEGVITVEEA       180
     KTAETELEVV EGMQFDRGYL SPYFVTNPEK MIADLEDVFI LLHEKKLSNL QSMLPVLEAV       240
     VQTGKPLLIV AEDVEGEALA TLVVNKLRGG LKIAAVKAPG FGDRRKAMLE DIAILTGGTV       300
     ISEDLGIKLE SVTLDMLGRA KKVSISKENT TIVDGSGAKT DIEGRVAQIK AQIEETTSDY       360
     DREKLQERLA KLAGGVAVIR VGGSTEVEVK EKKDRIDDAL NATRAAVQEG IVPGGGIALL       420
     RSSTKITVKG ANDDQEAGIN IVRRALQSLV RQIAENAGDE ASIVVGKVLD KNEDNYGYNA       480
     QTSEYGDMIA MGIVDPLKVV RTALQNAASV ASLLITTEAM IAELPKKESA GGGMPGGMGG       540
     MGGMDMM                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page