(data stored in ACNUC7421 zone)

EMBL: CP001622.PE509

CP001622.PE509       Location/Qualifiers
FT   CDS             complement(537014..537310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0516"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: smd:Smed_6083
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54821"
FT                   /db_xref="GOA:C6B2K1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K1"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ACS54821.1"
FT                   /translation="MASTNFRPLHDRVVVRRVESEAKTKGGIIIPDTAKEKPQEGEIVA
FT                   VGSGARDESGKVVALDVKAGDRILFGKWSGTEVKIDGEDLLIMKEADIMGIIG"
     MASTNFRPLH DRVVVRRVES EAKTKGGIII PDTAKEKPQE GEIVAVGSGA RDESGKVVAL        60
     DVKAGDRILF GKWSGTEVKI DGEDLLIMKE ADIMGIIG                                98
//

If you have problems or comments...

PBIL Back to PBIL home page