(data stored in ACNUC7421 zone)

EMBL: CP001622.PE51

CP001622.PE51        Location/Qualifiers
FT   CDS             complement(53662..54165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0052"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: ret:RHE_CH00392
FT                   lipoprotein signal peptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54363"
FT                   /db_xref="GOA:C6AYD9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD9"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ACS54363.1"
FT                   /translation="MTEQTHARPALFSRPAPILFFIVVAVLIDQAVKIAVDHYLPLQEA
FT                   VPVVPMLALYRTYNLGVAFSMLSGMDGWFIVGMRLIIVAFVIWLWYRTAKDRWIAHLGY
FT                   ALIIAGAIGNLVDRFAYGHVIDYILFYTESWSFAVFNLADSFITIGAGCVILDELLLPK
FT                   KASR"
     MTEQTHARPA LFSRPAPILF FIVVAVLIDQ AVKIAVDHYL PLQEAVPVVP MLALYRTYNL        60
     GVAFSMLSGM DGWFIVGMRL IIVAFVIWLW YRTAKDRWIA HLGYALIIAG AIGNLVDRFA       120
     YGHVIDYILF YTESWSFAVF NLADSFITIG AGCVILDELL LPKKASR                     167
//

If you have problems or comments...

PBIL Back to PBIL home page