(data stored in ACNUC7421 zone)

EMBL: CP001622.PE510

CP001622.PE510       Location/Qualifiers
FT   CDS             537705..538553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0517"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   HAD-superfamily subfamily IIA hydrolase like protein; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   ret:RHE_CH00830 putative hydrolase, haloacid
FT                   dehalogenase-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54822"
FT                   /db_xref="GOA:C6B2K2"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K2"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACS54822.1"
FT                   /translation="MAKRIENFSEISGRYDVVLCDVWGVVHNGVDPFPKAAAALEAARE
FT                   NGLAVVLITNSPRLSWQVVDQLRQIGVPDSAYDRIVTSGDVTRGLIAEGPKTVFLLGPE
FT                   RDKALLEGIGVERRPAGEAQSLVCTGFFDDETEKPEDYTDMLLDFKARDVPMICANPDL
FT                   IVERGHRIIPCAGAMAAYYEQLGGKTRIAGKPHRPIYEATLAAARELRGDFPVDRVLAI
FT                   GDGMPTDVRGALNYGLDLLYISGGIHAKEYTLNGETDEAILNAYLERENAAPKWWMPRL
FT                   A"
     MAKRIENFSE ISGRYDVVLC DVWGVVHNGV DPFPKAAAAL EAARENGLAV VLITNSPRLS        60
     WQVVDQLRQI GVPDSAYDRI VTSGDVTRGL IAEGPKTVFL LGPERDKALL EGIGVERRPA       120
     GEAQSLVCTG FFDDETEKPE DYTDMLLDFK ARDVPMICAN PDLIVERGHR IIPCAGAMAA       180
     YYEQLGGKTR IAGKPHRPIY EATLAAAREL RGDFPVDRVL AIGDGMPTDV RGALNYGLDL       240
     LYISGGIHAK EYTLNGETDE AILNAYLERE NAAPKWWMPR LA                          282
//

If you have problems or comments...

PBIL Back to PBIL home page