(data stored in ACNUC7421 zone)

EMBL: CP001622.PE511

CP001622.PE511       Location/Qualifiers
FT   CDS             538585..539568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0518"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   FAD synthetase; Riboflavin kinase; KEGG:
FT                   rec:RHECIAT_CH0000917 riboflavin kinase/FMN
FT                   adenylyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54823"
FT                   /db_xref="GOA:C6B2K3"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K3"
FT                   /inference="protein motif:TFAM:TIGR00083"
FT                   /protein_id="ACS54823.1"
FT                   /translation="MTVFHRNETREPLPAHLKGGVIAIGNFDGVHRGHQSVLSRALEIS
FT                   KARGIPALVLTFEPHPRTVFRPQTPVFRLTPAPLKARILETLGFSAVIEYPFDYEFSQR
FT                   SADDFIHSILKDWLGASEVVTGFDFHFGRGREGGPAFLMNAGHTYGFGVTLIDAFRDEN
FT                   ADVVSSSHIRALLKEGNVSEVAGMLGYRYTVEAEVIDGEKLGRQLGFPTANMRLPPEVD
FT                   LAAGIYAVRFRRQDGTLHDAVASYGRRPTVTENGAPLLETYLFDFSGDLYGQLCSVSFF
FT                   GYLRPELKFDGLDPLVAQIKRDEEEARALLAGVKPLGALDRKLCFS"
     MTVFHRNETR EPLPAHLKGG VIAIGNFDGV HRGHQSVLSR ALEISKARGI PALVLTFEPH        60
     PRTVFRPQTP VFRLTPAPLK ARILETLGFS AVIEYPFDYE FSQRSADDFI HSILKDWLGA       120
     SEVVTGFDFH FGRGREGGPA FLMNAGHTYG FGVTLIDAFR DENADVVSSS HIRALLKEGN       180
     VSEVAGMLGY RYTVEAEVID GEKLGRQLGF PTANMRLPPE VDLAAGIYAV RFRRQDGTLH       240
     DAVASYGRRP TVTENGAPLL ETYLFDFSGD LYGQLCSVSF FGYLRPELKF DGLDPLVAQI       300
     KRDEEEARAL LAGVKPLGAL DRKLCFS                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page