(data stored in ACNUC7421 zone)

EMBL: CP001622.PE512

CP001622.PE512       Location/Qualifiers
FT   CDS             539856..542747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0519"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   rec:RHECIAT_CH0000920 isoleucyl-tRNA synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54824"
FT                   /db_xref="GOA:C6B2K4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K4"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ACS54824.1"
FT                   /translation="MTDTAEKIDYSKTLYLPETDFPMRAGLPQKEPELVKRWQEMGLYK
FT                   KLRASAAGREKFVLHDGPPYANGNIHIGHALNKILKDVINRSFQMRGYDANYVPGWDCH
FT                   GLPIEWKIEEKYREKGKNKDEVPVNEFRRECREFAAGWIKVQAEEFKRLGIEGDFDNPY
FT                   TTMNFHAESRIAGELLKIAASGQLYRGSKPIMWSVVERTALAEAEVEYQDYESDTIWVK
FT                   FPVVEGPVALKDAFVVIWTTTPWTIPGNRAVSFSPRISYGLYEVTAAENDFGPRPGEKL
FT                   IFADKLAEESFAKAKLQYKRLSDVSAADFAAMTCAHPFKGLGGGYEFRVPLLDGDHVTD
FT                   DAGTGFVHTAPSHGREDFDAWMSAVRALEARGIDTKIPFPVDDGGFYTSDAPGFEGARV
FT                   IDDNGKKGDANDRVIRELIARGALFARGRLKHQYPHSWRSKKPVIFRNTPQWFVYMDKT
FT                   LADGTTLRSRALGAIDDTRFVPAAGQNRLRAMIEGRPDWVLSRQRAWGVPIAVFADDDG
FT                   DVLVDEAVNARILEAFEHEGADAWFAEGAKERFLGNDHDHSRWTQVMDILDVWFDSGST
FT                   HTFTLEDRPDLKWPADLYLEGSDQHRGWFHSSLLESAATRGRAPYNAVLTHGFTMDEKG
FT                   EKMSKSKGNVTAPQEVMKDAGADILRLWVMTSDYADDLRVGKTIIQTNVDAYRKLRNTI
FT                   RWMLGTLAHDKGEEIALADLPELEQLMLHRLAELDELVRENYDAFDFKKIARALIDFAN
FT                   VELSAFYFDVRKDALYCDAPSSLRRRASLHVIRQIFDCMVTWLAPMLPFTTEEAWLSRN
FT                   PSAVSVHLEQFAPVAKEWRNDALAEKWKKIRTVRSVVTGALEIERKDKRIGSSLEAAPV
FT                   VHIADPELLKALEGQDFTEVCITSAIEIKVGEGPGDAFRLAEVPQVSVVPKLAEGEKCA
FT                   RSWRITRDVGSDPEYPDVSARDAAALRELAALT"
     MTDTAEKIDY SKTLYLPETD FPMRAGLPQK EPELVKRWQE MGLYKKLRAS AAGREKFVLH        60
     DGPPYANGNI HIGHALNKIL KDVINRSFQM RGYDANYVPG WDCHGLPIEW KIEEKYREKG       120
     KNKDEVPVNE FRRECREFAA GWIKVQAEEF KRLGIEGDFD NPYTTMNFHA ESRIAGELLK       180
     IAASGQLYRG SKPIMWSVVE RTALAEAEVE YQDYESDTIW VKFPVVEGPV ALKDAFVVIW       240
     TTTPWTIPGN RAVSFSPRIS YGLYEVTAAE NDFGPRPGEK LIFADKLAEE SFAKAKLQYK       300
     RLSDVSAADF AAMTCAHPFK GLGGGYEFRV PLLDGDHVTD DAGTGFVHTA PSHGREDFDA       360
     WMSAVRALEA RGIDTKIPFP VDDGGFYTSD APGFEGARVI DDNGKKGDAN DRVIRELIAR       420
     GALFARGRLK HQYPHSWRSK KPVIFRNTPQ WFVYMDKTLA DGTTLRSRAL GAIDDTRFVP       480
     AAGQNRLRAM IEGRPDWVLS RQRAWGVPIA VFADDDGDVL VDEAVNARIL EAFEHEGADA       540
     WFAEGAKERF LGNDHDHSRW TQVMDILDVW FDSGSTHTFT LEDRPDLKWP ADLYLEGSDQ       600
     HRGWFHSSLL ESAATRGRAP YNAVLTHGFT MDEKGEKMSK SKGNVTAPQE VMKDAGADIL       660
     RLWVMTSDYA DDLRVGKTII QTNVDAYRKL RNTIRWMLGT LAHDKGEEIA LADLPELEQL       720
     MLHRLAELDE LVRENYDAFD FKKIARALID FANVELSAFY FDVRKDALYC DAPSSLRRRA       780
     SLHVIRQIFD CMVTWLAPML PFTTEEAWLS RNPSAVSVHL EQFAPVAKEW RNDALAEKWK       840
     KIRTVRSVVT GALEIERKDK RIGSSLEAAP VVHIADPELL KALEGQDFTE VCITSAIEIK       900
     VGEGPGDAFR LAEVPQVSVV PKLAEGEKCA RSWRITRDVG SDPEYPDVSA RDAAALRELA       960
     ALT                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page