(data stored in ACNUC7421 zone)

EMBL: CP001622.PE513

CP001622.PE513       Location/Qualifiers
FT   CDS             542881..543510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54825"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K5"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000921"
FT                   /protein_id="ACS54825.1"
FT                   /translation="MLATHWFRMGACLSVVVAGCSLVSGCASSPTYGTDKTAMEQLTDD
FT                   LGQSVSLTGPDPKNKGVKYTPRPTLVLPAQAQKETLVAPQQTVANKDNPQWLESPEETR
FT                   ARLVSEADANEDNPNYRSPLASSAIEGGRRTTEAQTKAYREARALQKGSYVDQRRYISD
FT                   PPPGYRTVDDPAKLDDVGEPELKKQKKRKKDAAVANTGKQWWNLLQ"
     MLATHWFRMG ACLSVVVAGC SLVSGCASSP TYGTDKTAME QLTDDLGQSV SLTGPDPKNK        60
     GVKYTPRPTL VLPAQAQKET LVAPQQTVAN KDNPQWLESP EETRARLVSE ADANEDNPNY       120
     RSPLASSAIE GGRRTTEAQT KAYREARALQ KGSYVDQRRY ISDPPPGYRT VDDPAKLDDV       180
     GEPELKKQKK RKKDAAVANT GKQWWNLLQ                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page