(data stored in ACNUC7421 zone)

EMBL: CP001622.PE514

CP001622.PE514       Location/Qualifiers
FT   CDS             complement(543564..544001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0521"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   rec:RHECIAT_CH0000922 cytosine deaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54826"
FT                   /db_xref="GOA:C6B2K6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K6"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACS54826.1"
FT                   /translation="MEMALEEARAAGERGEVPIGAVVVIDDIAVSRSGNRTRELKDVTA
FT                   HAEIAAIRLACEALGQERLAGADLYVTLEPCTMCAAAISFARIRRLYYGAEDPKGGGVD
FT                   NGVRFYGQPTCHHAPEVYSGFNEVQSANLLRRFFSQRREAP"
     MEMALEEARA AGERGEVPIG AVVVIDDIAV SRSGNRTREL KDVTAHAEIA AIRLACEALG        60
     QERLAGADLY VTLEPCTMCA AAISFARIRR LYYGAEDPKG GGVDNGVRFY GQPTCHHAPE       120
     VYSGFNEVQS ANLLRRFFSQ RREAP                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page