(data stored in ACNUC7421 zone)

EMBL: CP001622.PE515

CP001622.PE515       Location/Qualifiers
FT   CDS             544092..546188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0522"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; SMART: RNA-binding S4 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000923 probable RNA-pseudouridine synthase
FT                   protein, ribosomal large subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54827"
FT                   /db_xref="GOA:C6B2K7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K7"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACS54827.1"
FT                   /translation="MTPKDKPKRPGAKPLSRDIRSKAGPKADGDKPAKPAVARAIAAET
FT                   DSDAKAERISKVMARAGVASRRDIERMIMEGRVTLNGRVLDTPVVNVTLADRIEVDGVP
FT                   IRGIERTRLWLYHKPTGLVTTNADPEGRSTVFDNLPEELPRVMSIGRLDINTEGLLLLT
FT                   NDGGLARALELPATGWLRRYRVRAHGEIDQDALDKLKDGIAVDGVLYGSIEATLDRTQG
FT                   SNVWITMGLREGKNREIKNVLGALGLDVNRLIRISYGPFQLGDLPESHVVEVRGRTLRD
FT                   QLGPRLIEEAKANFDAPIYNTTAVAAEEEAEPAAPEKRERPRRDEDKRERALSRLDTKR
FT                   DDRHGGARKEDDRRDGGRRDDEKPKRPQPLGQRRSANVWMAPGARPLGEKAAAKAAKNA
FT                   QTARRRGEQAPAKNDRIEDRPRTQVNRVREEDGEWIRSSEQPRGKDEGEGFGRKRGFGD
FT                   RPAREDRGSGDRPARGDRPFGDRPPRGDRPFGDKPRGDRKPRADGDERPRAARSPAGEG
FT                   RSERPRGDRPFGDRPSRGDRPFGDKPRGDRKPRADGDERPRAARTSPGEGRSERPRSDR
FT                   PSGDRPSRGDRPFGDKPRGDRRPREDGDERPRAARSFAGEGRSERPRGDKPSGDRPSGD
FT                   RPRGKGFAAKPSGAKPGGAKSFSGKPKGTKPGGDRPGGDRPAGGPSRGGAKGKGMTRGA
FT                   DRRR"
     MTPKDKPKRP GAKPLSRDIR SKAGPKADGD KPAKPAVARA IAAETDSDAK AERISKVMAR        60
     AGVASRRDIE RMIMEGRVTL NGRVLDTPVV NVTLADRIEV DGVPIRGIER TRLWLYHKPT       120
     GLVTTNADPE GRSTVFDNLP EELPRVMSIG RLDINTEGLL LLTNDGGLAR ALELPATGWL       180
     RRYRVRAHGE IDQDALDKLK DGIAVDGVLY GSIEATLDRT QGSNVWITMG LREGKNREIK       240
     NVLGALGLDV NRLIRISYGP FQLGDLPESH VVEVRGRTLR DQLGPRLIEE AKANFDAPIY       300
     NTTAVAAEEE AEPAAPEKRE RPRRDEDKRE RALSRLDTKR DDRHGGARKE DDRRDGGRRD       360
     DEKPKRPQPL GQRRSANVWM APGARPLGEK AAAKAAKNAQ TARRRGEQAP AKNDRIEDRP       420
     RTQVNRVREE DGEWIRSSEQ PRGKDEGEGF GRKRGFGDRP AREDRGSGDR PARGDRPFGD       480
     RPPRGDRPFG DKPRGDRKPR ADGDERPRAA RSPAGEGRSE RPRGDRPFGD RPSRGDRPFG       540
     DKPRGDRKPR ADGDERPRAA RTSPGEGRSE RPRSDRPSGD RPSRGDRPFG DKPRGDRRPR       600
     EDGDERPRAA RSFAGEGRSE RPRGDKPSGD RPSGDRPRGK GFAAKPSGAK PGGAKSFSGK       660
     PKGTKPGGDR PGGDRPAGGP SRGGAKGKGM TRGADRRR                               698
//

If you have problems or comments...

PBIL Back to PBIL home page