(data stored in ACNUC7421 zone)

EMBL: CP001622.PE516

CP001622.PE516       Location/Qualifiers
FT   CDS             546169..546729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0523"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative; KEGG: rec:RHECIAT_CH0000924
FT                   putative methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54828"
FT                   /db_xref="GOA:C6B2K8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K8"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ACS54828.1"
FT                   /translation="MRIVGGEFRGRPLAVPKSNEIRPTADRTRESLFNILSHAYPECVD
FT                   GTRILDLFAGTGAVGLEAVSRGCRHALFVENSVEGRALLWENIDALGLHGRTRILRRDA
FT                   TDLGSVGNLDPFDVLFADPPYGKGLGEKAMAAAVEGGWLRPGAIAVLEERADIVVSVHP
FT                   SYVFLESRIFGDTRVHFFRYQPQ"
     MRIVGGEFRG RPLAVPKSNE IRPTADRTRE SLFNILSHAY PECVDGTRIL DLFAGTGAVG        60
     LEAVSRGCRH ALFVENSVEG RALLWENIDA LGLHGRTRIL RRDATDLGSV GNLDPFDVLF       120
     ADPPYGKGLG EKAMAAAVEG GWLRPGAIAV LEERADIVVS VHPSYVFLES RIFGDTRVHF       180
     FRYQPQ                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page