(data stored in ACNUC7421 zone)

EMBL: CP001622.PE517

CP001622.PE517       Location/Qualifiers
FT   CDS             546742..547623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0524"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rec:RHECIAT_CH0000925 putative
FT                   hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54829"
FT                   /db_xref="GOA:C6B2K9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K9"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACS54829.1"
FT                   /translation="MQQAEIISPKLPAISDVPTVAVAFGGGGARGLAHIHVIETLDELG
FT                   IRPVAVSGSSIGAIMAAGMAAGMSGAEIREHALTTVGNKTAVVARIWGLRPATVRDAVA
FT                   KGIRIGQFNLERILKAFLPSELPARFEDLLVPMKVITTDYYGQCEVIIEQGELFPALAA
FT                   SSAIPAVFMPVRLRDRVMIDGGISNPVPYECLMDLADIVVGIDVVGAPEGDGTHIPNRM
FT                   ESIFGSGQLMMQTAISLKLKLRPPHIFLRPTVGRTGVMDFLKAREVLAMSVGVKDDLKF
FT                   ALDREIEARLKR"
     MQQAEIISPK LPAISDVPTV AVAFGGGGAR GLAHIHVIET LDELGIRPVA VSGSSIGAIM        60
     AAGMAAGMSG AEIREHALTT VGNKTAVVAR IWGLRPATVR DAVAKGIRIG QFNLERILKA       120
     FLPSELPARF EDLLVPMKVI TTDYYGQCEV IIEQGELFPA LAASSAIPAV FMPVRLRDRV       180
     MIDGGISNPV PYECLMDLAD IVVGIDVVGA PEGDGTHIPN RMESIFGSGQ LMMQTAISLK       240
     LKLRPPHIFL RPTVGRTGVM DFLKAREVLA MSVGVKDDLK FALDREIEAR LKR              293
//

If you have problems or comments...

PBIL Back to PBIL home page