(data stored in ACNUC7421 zone)

EMBL: CP001622.PE518

CP001622.PE518       Location/Qualifiers
FT   CDS             complement(547636..548088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54830"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L0"
FT                   /inference="similar to AA sequence:KEGG:Avi_7626"
FT                   /protein_id="ACS54830.1"
FT                   /translation="MKKIIAIVAGVLLASMASADDDPQQAIPARLKVMFERPDKPLDIA
FT                   PVVVQGDWAIVGWRQDGRGGRALMKKTHHGWSIYLCSGDSLKDTATLETIGLSAVDAAG
FT                   LAAKLKNAEAGLDSSALALFSSFEGTMMMNEASNGAGHAGHEGHAQ"
     MKKIIAIVAG VLLASMASAD DDPQQAIPAR LKVMFERPDK PLDIAPVVVQ GDWAIVGWRQ        60
     DGRGGRALMK KTHHGWSIYL CSGDSLKDTA TLETIGLSAV DAAGLAAKLK NAEAGLDSSA       120
     LALFSSFEGT MMMNEASNGA GHAGHEGHAQ                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page