(data stored in ACNUC7421 zone)

EMBL: CP001622.PE519

CP001622.PE519       Location/Qualifiers
FT   CDS             complement(548102..549475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0526"
FT                   /product="Propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4;
FT                   PepSY-associated TM helix domain protein; KEGG: cysJ;
FT                   sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54831"
FT                   /db_xref="GOA:C6B2L1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L1"
FT                   /inference="protein motif:PFAM:PF03413"
FT                   /protein_id="ACS54831.1"
FT                   /translation="MSTITAAEPAEHAADGVSLYRAIWRWHFFAGLLVIPFLLNLAVTG
FT                   SLYLFKDEINSTFFGYRYSVQPAGEALSPERIAEIAASAVPGSTATSYKDPVLPERSAI
FT                   VTLSSDAGSMLVFVNPYDGKVLDVVGSTDEFNYVVKRIHSLAYFGTITNRLIEIAGGFA
FT                   MVLVVTGIYLWWPRRQTGGVISVRGTPGRRVFWRDLHAVTGAFAGILIFFLAMSGMPWS
FT                   GYWGANANAWLTEHGLGYPVQLWGDVPKSRKVTEDILPNSGWIVEKAPVPLSDIAAAQS
FT                   ARPIGLEKAVETAKRLGMAPGFDLAIPSDETGVYTASLFPDDLADERTLHIDQYSGKPL
FT                   IDIGFDQYPFLGKAIEWGINVHQGQEWGRFNQLLMLATCLAIVLSCVTAIVMWWKRRPI
FT                   GRLGVPPMPPKPSIYYGLWVIVGIFAVTFPMSGLAIVAMIAFDQIVVRFVPLLKRVLA"
     MSTITAAEPA EHAADGVSLY RAIWRWHFFA GLLVIPFLLN LAVTGSLYLF KDEINSTFFG        60
     YRYSVQPAGE ALSPERIAEI AASAVPGSTA TSYKDPVLPE RSAIVTLSSD AGSMLVFVNP       120
     YDGKVLDVVG STDEFNYVVK RIHSLAYFGT ITNRLIEIAG GFAMVLVVTG IYLWWPRRQT       180
     GGVISVRGTP GRRVFWRDLH AVTGAFAGIL IFFLAMSGMP WSGYWGANAN AWLTEHGLGY       240
     PVQLWGDVPK SRKVTEDILP NSGWIVEKAP VPLSDIAAAQ SARPIGLEKA VETAKRLGMA       300
     PGFDLAIPSD ETGVYTASLF PDDLADERTL HIDQYSGKPL IDIGFDQYPF LGKAIEWGIN       360
     VHQGQEWGRF NQLLMLATCL AIVLSCVTAI VMWWKRRPIG RLGVPPMPPK PSIYYGLWVI       420
     VGIFAVTFPM SGLAIVAMIA FDQIVVRFVP LLKRVLA                                457
//

If you have problems or comments...

PBIL Back to PBIL home page