(data stored in ACNUC7421 zone)

EMBL: CP001622.PE52

CP001622.PE52        Location/Qualifiers
FT   CDS             complement(54162..55022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0053"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   ret:RHE_CH00393 rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54364"
FT                   /db_xref="GOA:C6AYE0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE0"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACS54364.1"
FT                   /translation="MSKDFHDQGPRRVGQVKEVTSLANPIIKDIKALTNKKSREESGTF
FT                   LAEGLKLIIDAIELGWAIRTLVYAKAAKGKPLVEQMAAKTVASGGLVLEVSEKVIASIT
FT                   RRDNPQMVVGIFEQRWTPLKGIRLSDGETWVALDRVRDPGNLGTIIRTADAAGASGIIL
FT                   LGETTDPFSLETVRATMGSVFAVPVARATPEEFIAWRKSAGVSVVATHLAGAVDYRTID
FT                   YRKKPVVLLMGNEQSGLPEQLAREADALARIPQQGRADSLNLAVATAVMLFEARRHLLS
FT                   LAEGK"
     MSKDFHDQGP RRVGQVKEVT SLANPIIKDI KALTNKKSRE ESGTFLAEGL KLIIDAIELG        60
     WAIRTLVYAK AAKGKPLVEQ MAAKTVASGG LVLEVSEKVI ASITRRDNPQ MVVGIFEQRW       120
     TPLKGIRLSD GETWVALDRV RDPGNLGTII RTADAAGASG IILLGETTDP FSLETVRATM       180
     GSVFAVPVAR ATPEEFIAWR KSAGVSVVAT HLAGAVDYRT IDYRKKPVVL LMGNEQSGLP       240
     EQLAREADAL ARIPQQGRAD SLNLAVATAV MLFEARRHLL SLAEGK                      286
//

If you have problems or comments...

PBIL Back to PBIL home page