(data stored in ACNUC7421 zone)

EMBL: CP001622.PE520

CP001622.PE520       Location/Qualifiers
FT   CDS             complement(549565..549972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54832"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L2"
FT                   /inference="similar to AA sequence:KEGG:Arad_3792"
FT                   /protein_id="ACS54832.1"
FT                   /translation="MIRRTRQIEQWALRILCAVALVFVGFAHQVPLAAAGEFDPAELAQ
FT                   YVLPDGTLPTLCVTTTDTSGQEQHDKAHSHGCEACRISASILLPAPTDIAGSAIHFAAT
FT                   VELPIRAEAFHRQLFPPNTGPRAPPSDPIPA"
     MIRRTRQIEQ WALRILCAVA LVFVGFAHQV PLAAAGEFDP AELAQYVLPD GTLPTLCVTT        60
     TDTSGQEQHD KAHSHGCEAC RISASILLPA PTDIAGSAIH FAATVELPIR AEAFHRQLFP       120
     PNTGPRAPPS DPIPA                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page