(data stored in ACNUC7421 zone)

EMBL: CP001622.PE521

CP001622.PE521       Location/Qualifiers
FT   CDS             complement(550064..551878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0528"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   sodium/hydrogen exchanger; TrkA-N domain protein; KEGG:
FT                   rec:RHECIAT_CH0000928 glutathione-regulated
FT                   potassium-efflux transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54833"
FT                   /db_xref="GOA:C6B2L3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L3"
FT                   /inference="protein motif:TFAM:TIGR00932"
FT                   /protein_id="ACS54833.1"
FT                   /translation="MSASNAFFSETILLLGGAVVAAPIFKKLGLGTVLGYLAAGIVIGP
FT                   VFHGITDGEQILAVAELGVVFLLFIIGLELKPTRLWQMRRDIFGLGAAQVVLTGLALTA
FT                   LAWFSQVLDWRGSIVAGFGLALSSTAFAMQILEGDGDVNTRYGQRSFSMLLFQDLAIVP
FT                   LLALITILDGGDKGSNAPLFDFAIAVGAVAAMIVMGRYLLTPLFQIIARTGAREAMIAA
FT                   ALFVVMGSASLMQLAGLSMAMGAFLSGVMLAESSYRHELEADIEPFRGVLLAIFFIAVG
FT                   LSLELDVLADNALFVIVAVPIVMAVKAIVIYGICRISGSSHDDAIRIAFLLPQGGEFGF
FT                   VLFTTAGAAGLMSTSTASLLVAIVTLSMALTPIGSALSKRLLNGDEQEELDEDFEGAGA
FT                   DVLMVGFSRFGQIAAQILLAGGRSVTVIDFSADRIRQASSFGFRIYFGDGARKDVLRSA
FT                   GIDRAKIVLVCTQKKEITDKVVELVQADYPHTRLYVRSYDRIHSIELRNKGIDYELRET
FT                   LESGLLFGRRTLEALGVSEVDAYEIGEDIRKRDEARLVLQVSEGLQAGRDMLFSHPVRP
FT                   EPLVKPKRAADPFEHDPLAGTADATADA"
     MSASNAFFSE TILLLGGAVV AAPIFKKLGL GTVLGYLAAG IVIGPVFHGI TDGEQILAVA        60
     ELGVVFLLFI IGLELKPTRL WQMRRDIFGL GAAQVVLTGL ALTALAWFSQ VLDWRGSIVA       120
     GFGLALSSTA FAMQILEGDG DVNTRYGQRS FSMLLFQDLA IVPLLALITI LDGGDKGSNA       180
     PLFDFAIAVG AVAAMIVMGR YLLTPLFQII ARTGAREAMI AAALFVVMGS ASLMQLAGLS       240
     MAMGAFLSGV MLAESSYRHE LEADIEPFRG VLLAIFFIAV GLSLELDVLA DNALFVIVAV       300
     PIVMAVKAIV IYGICRISGS SHDDAIRIAF LLPQGGEFGF VLFTTAGAAG LMSTSTASLL       360
     VAIVTLSMAL TPIGSALSKR LLNGDEQEEL DEDFEGAGAD VLMVGFSRFG QIAAQILLAG       420
     GRSVTVIDFS ADRIRQASSF GFRIYFGDGA RKDVLRSAGI DRAKIVLVCT QKKEITDKVV       480
     ELVQADYPHT RLYVRSYDRI HSIELRNKGI DYELRETLES GLLFGRRTLE ALGVSEVDAY       540
     EIGEDIRKRD EARLVLQVSE GLQAGRDMLF SHPVRPEPLV KPKRAADPFE HDPLAGTADA       600
     TADA                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page