(data stored in ACNUC7421 zone)

EMBL: CP001622.PE522

CP001622.PE522       Location/Qualifiers
FT   CDS             551998..553344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0529"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   rec:RHECIAT_CH0000929 modulator of DNA gyrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54834"
FT                   /db_xref="GOA:C6B2L4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L4"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACS54834.1"
FT                   /translation="MSSEIDSSTLLSRASQLIDLARKAGADAADAVVVRSRSQSVSVRL
FT                   GKVEGTESSESDDFSLRVFIGKRVASVSANPGFDLQALAERAVAMAKVSPEDPFACLAD
FT                   EASLSRSYPDLQLLDTTEVSSEMLREAGLAAEAAALAVKGVTNSSGAGASAGMGGLVLA
FT                   TSHGFEGSYMASRFGHSVSVIAGEGTGMERDYDYDSRLYYAELDDPAEIGRRAGERVIK
FT                   RINPRQVPTGKDITVIFDPRVARGFVGHIAGAINGAAVARKSSFLRDKMGQQILKSGLS
FT                   ITDDPLIVRGPSSRPFDGEGVSGERLVMIEDGVLKHWFLSTSTARELDLETNGRGVRGG
FT                   TAVSPSSTNLALEPGDISPEDLIRSVGNGFYVTELIGHGVNMITGEYSRGATGFWIENG
FT                   ELTFPVSEVTIASNLKEMFMRLTLANDIDRKFGVAAPTFAIEGMTLAGR"
     MSSEIDSSTL LSRASQLIDL ARKAGADAAD AVVVRSRSQS VSVRLGKVEG TESSESDDFS        60
     LRVFIGKRVA SVSANPGFDL QALAERAVAM AKVSPEDPFA CLADEASLSR SYPDLQLLDT       120
     TEVSSEMLRE AGLAAEAAAL AVKGVTNSSG AGASAGMGGL VLATSHGFEG SYMASRFGHS       180
     VSVIAGEGTG MERDYDYDSR LYYAELDDPA EIGRRAGERV IKRINPRQVP TGKDITVIFD       240
     PRVARGFVGH IAGAINGAAV ARKSSFLRDK MGQQILKSGL SITDDPLIVR GPSSRPFDGE       300
     GVSGERLVMI EDGVLKHWFL STSTARELDL ETNGRGVRGG TAVSPSSTNL ALEPGDISPE       360
     DLIRSVGNGF YVTELIGHGV NMITGEYSRG ATGFWIENGE LTFPVSEVTI ASNLKEMFMR       420
     LTLANDIDRK FGVAAPTFAI EGMTLAGR                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page