(data stored in ACNUC7421 zone)

EMBL: CP001622.PE523

CP001622.PE523       Location/Qualifiers
FT   CDS             553527..554336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0530"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG:
FT                   ret:RHE_CH00842 inositol monophosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54835"
FT                   /db_xref="GOA:C6B2L5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L5"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ACS54835.1"
FT                   /translation="MSDMEKARWQSDLTLIADAAKEAGAVAFGFFNQSPEVWWKNEDRS
FT                   PVSAADFAANKTLETILRKARPDYGWLSEETDDDADRLSRETLFIIDPIDGTRAFLGGQ
FT                   KVWCVSVAVVHRGRPVAGVLYAPALEEFYEAVEGGVALKNGVPFTVSAAGPEEMSRLAI
FT                   GEDLLKTFPTEFRDRVTREKYIPSLAYRIAMVADGRLDGTFVKGNSHDWDLAAADLILV
FT                   CAGGGLVDIEGRPIVYNRAEVTHNVLCAAPTPRISEFLAAFAGRRDS"
     MSDMEKARWQ SDLTLIADAA KEAGAVAFGF FNQSPEVWWK NEDRSPVSAA DFAANKTLET        60
     ILRKARPDYG WLSEETDDDA DRLSRETLFI IDPIDGTRAF LGGQKVWCVS VAVVHRGRPV       120
     AGVLYAPALE EFYEAVEGGV ALKNGVPFTV SAAGPEEMSR LAIGEDLLKT FPTEFRDRVT       180
     REKYIPSLAY RIAMVADGRL DGTFVKGNSH DWDLAAADLI LVCAGGGLVD IEGRPIVYNR       240
     AEVTHNVLCA APTPRISEFL AAFAGRRDS                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page