(data stored in ACNUC7421 zone)

EMBL: CP001622.PE525

CP001622.PE525       Location/Qualifiers
FT   CDS             554817..556136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0532"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: rec:RHECIAT_CH0000932
FT                   3-deoxy-D-manno-octulosonic acid transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54837"
FT                   /db_xref="GOA:C6B2L7"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L7"
FT                   /inference="protein motif:PFAM:PF04413"
FT                   /protein_id="ACS54837.1"
FT                   /translation="MSSRMARFGLNAYRLAGTVASPVVGLYITYRTAKGKEDRARRLER
FT                   FGYPSANRPQGPLIWFHAASVGETNAVIPLIREIRRRDIHVILTTGTITSAKLAAERLG
FT                   LEAIHQYVPLDLKPSVSRFLDYWQPDCAIIAESEIWPATVLELGRRRIPQILINARMSD
FT                   RSFARWRRRPAIAEALFENLALVIAQSDVDAERFRDLGAVPVITSGNLKVDTDAPPYDS
FT                   AVFARYKKQIGERKTWAAISTFDGEENAAAIVHRALRERDRQLTIIVPRHPERSDEIEA
FT                   ALVKQGLKVARRTRDDVLSADVDIFLGDTIGEMGLYLRLTEIAFVGRSLFAEGGQNPLE
FT                   PAMLGCAILSGGHVQNFRDAYQKLARSGSARMVRDTEMLAKGVHYLLINDDARRNMIEA
FT                   GITAVHEMRGALTATVKGLEPYINPLTVKARLLPKAVAQV"
     MSSRMARFGL NAYRLAGTVA SPVVGLYITY RTAKGKEDRA RRLERFGYPS ANRPQGPLIW        60
     FHAASVGETN AVIPLIREIR RRDIHVILTT GTITSAKLAA ERLGLEAIHQ YVPLDLKPSV       120
     SRFLDYWQPD CAIIAESEIW PATVLELGRR RIPQILINAR MSDRSFARWR RRPAIAEALF       180
     ENLALVIAQS DVDAERFRDL GAVPVITSGN LKVDTDAPPY DSAVFARYKK QIGERKTWAA       240
     ISTFDGEENA AAIVHRALRE RDRQLTIIVP RHPERSDEIE AALVKQGLKV ARRTRDDVLS       300
     ADVDIFLGDT IGEMGLYLRL TEIAFVGRSL FAEGGQNPLE PAMLGCAILS GGHVQNFRDA       360
     YQKLARSGSA RMVRDTEMLA KGVHYLLIND DARRNMIEAG ITAVHEMRGA LTATVKGLEP       420
     YINPLTVKAR LLPKAVAQV                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page