(data stored in ACNUC7421 zone)

EMBL: CP001622.PE526

CP001622.PE526       Location/Qualifiers
FT   CDS             556146..556868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0533"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ret:RHE_CH00845 phosphoglycolate
FT                   phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54838"
FT                   /db_xref="GOA:C6B2L8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L8"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACS54838.1"
FT                   /translation="MSAVASIKGILFDKDGTLLDYDESWLPVNRELARIAARGDELLAN
FT                   RLLSACGMDPVTGHIVPDSLLAAGNTRQIASGLVAAGSMVDVDELTVRLDDLFSSAAEF
FT                   SVPVTDLAGFFERLHRRGFKLGVASSDNERSIRQTAERFGFARYIDYIAGYDSGFGVKP
FT                   EPGMVLGFCAATGLLPEEVAMVGDNNHDLHMGLNAGTGLRIAVLTGTGSRETLAAAADH
FT                   VLDDITAIETLLPDLQPA"
     MSAVASIKGI LFDKDGTLLD YDESWLPVNR ELARIAARGD ELLANRLLSA CGMDPVTGHI        60
     VPDSLLAAGN TRQIASGLVA AGSMVDVDEL TVRLDDLFSS AAEFSVPVTD LAGFFERLHR       120
     RGFKLGVASS DNERSIRQTA ERFGFARYID YIAGYDSGFG VKPEPGMVLG FCAATGLLPE       180
     EVAMVGDNNH DLHMGLNAGT GLRIAVLTGT GSRETLAAAA DHVLDDITAI ETLLPDLQPA       240
//

If you have problems or comments...

PBIL Back to PBIL home page