(data stored in ACNUC7421 zone)

EMBL: CP001622.PE527

CP001622.PE527       Location/Qualifiers
FT   CDS             557052..558095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0534"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: ret:RHE_CH00846 tetraacyldisaccharide
FT                   4'-kinase; TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54839"
FT                   /db_xref="GOA:C6B2L9"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L9"
FT                   /inference="protein motif:TFAM:TIGR00682"
FT                   /protein_id="ACS54839.1"
FT                   /translation="MISEAPPFWWRKADWRAWLLLPLSFLYGRIASHRMAHARRASVPI
FT                   PVICVGNFTVGGAGKTPTALTIARAAKAKGLKPGFLSRGYGGSLDVTTVVDPDHHRAIA
FT                   VGDEPLLLAQEALTVISRRRVEGAARLVAEGADLIIMDDGFQSARLAIDYALLVIDATR
FT                   GLGNGHIVPGGPVRAPIRQQLRSATALLKVGGGNAADRIVRMAARAAKPYFTASLKVRG
FT                   DNTLAGTKVLAFAGIADPAKFFRTVESRGAEIVVAKSFGDHEHLTEEEIDDILTTAERQ
FT                   GLLIVTTSKDFVRLSGHQGKAARLVEKSRVIEVDMVFEDHLAPSLIIDRAIVACRERRL
FT                   REMKAGA"
     MISEAPPFWW RKADWRAWLL LPLSFLYGRI ASHRMAHARR ASVPIPVICV GNFTVGGAGK        60
     TPTALTIARA AKAKGLKPGF LSRGYGGSLD VTTVVDPDHH RAIAVGDEPL LLAQEALTVI       120
     SRRRVEGAAR LVAEGADLII MDDGFQSARL AIDYALLVID ATRGLGNGHI VPGGPVRAPI       180
     RQQLRSATAL LKVGGGNAAD RIVRMAARAA KPYFTASLKV RGDNTLAGTK VLAFAGIADP       240
     AKFFRTVESR GAEIVVAKSF GDHEHLTEEE IDDILTTAER QGLLIVTTSK DFVRLSGHQG       300
     KAARLVEKSR VIEVDMVFED HLAPSLIIDR AIVACRERRL REMKAGA                     347
//

If you have problems or comments...

PBIL Back to PBIL home page