(data stored in ACNUC7421 zone)

EMBL: CP001622.PE528

CP001622.PE528       Location/Qualifiers
FT   CDS             complement(558179..559084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0535"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sil:SPO2668 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54840"
FT                   /db_xref="GOA:C6B2M0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M0"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACS54840.1"
FT                   /translation="MELGWLEDFMELAAVRNFSTAAAARHVTQPAFSRRIRALENWIGA
FT                   ALIDRSSYPVRLTNAGETFLESSRELMREIYRVRDECRQQARAGIEVLTFSALHTIALS
FT                   IFPDLLTSVEQRTGPFITRMHATDFYDCVESLALGRCDIAFCYSHEFGPPVLQTGQFSS
FT                   KVIRIDPFHLVSKADQRGNPVIDLATWPGNEDMPLVAYSSDCFLGKVQTQLMLDMQKTG
FT                   RSFRVTYENSMSESVKRMILAGKGIGWLPESSATREIERNELCIVDARQAEVTLNVLAI
FT                   RKQGSGSAALERFWSNLQGL"
     MELGWLEDFM ELAAVRNFST AAAARHVTQP AFSRRIRALE NWIGAALIDR SSYPVRLTNA        60
     GETFLESSRE LMREIYRVRD ECRQQARAGI EVLTFSALHT IALSIFPDLL TSVEQRTGPF       120
     ITRMHATDFY DCVESLALGR CDIAFCYSHE FGPPVLQTGQ FSSKVIRIDP FHLVSKADQR       180
     GNPVIDLATW PGNEDMPLVA YSSDCFLGKV QTQLMLDMQK TGRSFRVTYE NSMSESVKRM       240
     ILAGKGIGWL PESSATREIE RNELCIVDAR QAEVTLNVLA IRKQGSGSAA LERFWSNLQG       300
     L                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page