(data stored in ACNUC7421 zone)

EMBL: CP001622.PE529

CP001622.PE529       Location/Qualifiers
FT   CDS             559252..560106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0536"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: dsh:Dshi_3150
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54841"
FT                   /db_xref="GOA:C6B2M1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M1"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACS54841.1"
FT                   /translation="MRQVYVNGDYLPETEARISVFDRGFLFADGVYEVTLVLDRKLVDF
FT                   AGHMRRLRHSLGELDMAFALTNEKLLDIHRELIRRNDIEEGLVYLQVTRGAADRDFLFP
FT                   ADATPRTVVVFTQKKSLVDSPLAERGLHVITVEDLRWRRCDIKTVQLLYPSMAKMEAKS
FT                   RGADDAWMVRDGFVTEGSSNNAYMVTLEGTVVTRDLSTDILRGITREAVLQCAQDLQLR
FT                   IEERPFTVEEVENAAEAFSTSSSGLVSPVVRINERVVGKGTPGPMAARLRQLYLERSRA
FT                   SAI"
     MRQVYVNGDY LPETEARISV FDRGFLFADG VYEVTLVLDR KLVDFAGHMR RLRHSLGELD        60
     MAFALTNEKL LDIHRELIRR NDIEEGLVYL QVTRGAADRD FLFPADATPR TVVVFTQKKS       120
     LVDSPLAERG LHVITVEDLR WRRCDIKTVQ LLYPSMAKME AKSRGADDAW MVRDGFVTEG       180
     SSNNAYMVTL EGTVVTRDLS TDILRGITRE AVLQCAQDLQ LRIEERPFTV EEVENAAEAF       240
     STSSSGLVSP VVRINERVVG KGTPGPMAAR LRQLYLERSR ASAI                        284
//

If you have problems or comments...

PBIL Back to PBIL home page