(data stored in ACNUC7421 zone)

EMBL: CP001622.PE53

CP001622.PE53        Location/Qualifiers
FT   CDS             complement(55019..56116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0054"
FT                   /product="putative SAM-dependent methyltransferase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000436 probable SAM-dependent
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54365"
FT                   /db_xref="GOA:C6AYE1"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000436"
FT                   /protein_id="ACS54365.1"
FT                   /translation="MKQREGRPGQKKTSGPSGENRRDDRAGRPPKPVAQPAATREAVRE
FT                   AAVPAAVVRPLMTRSGERPTERVPVILESLGAGDFHLIDSGNGEKLEQYGPYRIIRPEA
FT                   QALWRPSLAPQVWEKVDAAFTGDTDEEGAGRWRFPKEALGETWPLNLLGVDFLGRFTSF
FT                   RHVGVFPEQIVHWSWMKEQVEKAGRPLKVLNLFGYTGVASLVAAAAGAEVTHVDASKKA
FT                   IGWARENQALGRMEKLPIRWICEDAMKFILREERRGSQYDIILTDPPKFGRGPNGEVWH
FT                   LFEHLPLMLDVCREILSPKAVGLVLTAYSIRASFYSIHELMRETMRGAGGVVESGELVI
FT                   REAGTDGKTQGRALSTSLFSRWVPK"
     MKQREGRPGQ KKTSGPSGEN RRDDRAGRPP KPVAQPAATR EAVREAAVPA AVVRPLMTRS        60
     GERPTERVPV ILESLGAGDF HLIDSGNGEK LEQYGPYRII RPEAQALWRP SLAPQVWEKV       120
     DAAFTGDTDE EGAGRWRFPK EALGETWPLN LLGVDFLGRF TSFRHVGVFP EQIVHWSWMK       180
     EQVEKAGRPL KVLNLFGYTG VASLVAAAAG AEVTHVDASK KAIGWARENQ ALGRMEKLPI       240
     RWICEDAMKF ILREERRGSQ YDIILTDPPK FGRGPNGEVW HLFEHLPLML DVCREILSPK       300
     AVGLVLTAYS IRASFYSIHE LMRETMRGAG GVVESGELVI REAGTDGKTQ GRALSTSLFS       360
     RWVPK                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page