(data stored in ACNUC7421 zone)

EMBL: CP001622.PE530

CP001622.PE530       Location/Qualifiers
FT   CDS             complement(560318..560548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54842"
FT                   /db_xref="InterPro:IPR018661"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000936"
FT                   /protein_id="ACS54842.1"
FT                   /translation="MNLFEGHGNREAKIRYLDGDFQILSPGSYVVCAMTGKQIPLDELR
FT                   YWSVARQEPYADVISAIDADKRAGVLPNQRR"
     MNLFEGHGNR EAKIRYLDGD FQILSPGSYV VCAMTGKQIP LDELRYWSVA RQEPYADVIS        60
     AIDADKRAGV LPNQRR                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page