(data stored in ACNUC7421 zone)

EMBL: CP001622.PE531

CP001622.PE531       Location/Qualifiers
FT   CDS             complement(560667..562469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0539"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   MutL dimerisation; DNA mismatch repair protein domain
FT                   protein; ATP-binding region ATPase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000937 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54843"
FT                   /db_xref="GOA:C6B2M3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M3"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ACS54843.1"
FT                   /translation="MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIA
FT                   TSGGGKALLRVSDNGSGMDAADLELAVRRHCTSKISETLEDIRTLGFRGEALPSIGSVA
FT                   RLSIASRRRDSTGGHEIAVAGGKIAHMRPAAANPGTIVEVRDLFFATPARLKFLKTEKA
FT                   EAGAITEIVKRMAIAFPAVRFVLSGSDRTTLEFPATGDDHLARMAQVLGKEFRDNAIAL
FT                   DAVREEIALTGFAGVPTFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPV
FT                   AVLAITLDPALVDVNVHPAKSDVRFRDPSLVRGLIVGAIREALARDGSRAATTGASDML
FT                   RSFRPGFQPNNQRPQTAWSAETSPSQPYQPATGFGERPQASFDGLSMPTARAEPQFSPQ
FT                   PAVAEPNTRYPLGAARAQIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLA
FT                   SQVLLIPEIVDIPEEDCDRLMQHAAELSELGLAIERFGPGAIAVRETPAMLGEVDAHGL
FT                   IRQLADEIAEWDTASGLSAKLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSG
FT                   QCNHGRPTYIELKLSDIERLFGRS"
     MAIRQLSETL INQIAAGEVI ERPASAAKEL IENALDAGAT RIEIATSGGG KALLRVSDNG        60
     SGMDAADLEL AVRRHCTSKI SETLEDIRTL GFRGEALPSI GSVARLSIAS RRRDSTGGHE       120
     IAVAGGKIAH MRPAAANPGT IVEVRDLFFA TPARLKFLKT EKAEAGAITE IVKRMAIAFP       180
     AVRFVLSGSD RTTLEFPATG DDHLARMAQV LGKEFRDNAI ALDAVREEIA LTGFAGVPTF       240
     NRGNSAHQYA FVNGRPVQDK LILSAIRGAY AETIPSGRYP VAVLAITLDP ALVDVNVHPA       300
     KSDVRFRDPS LVRGLIVGAI REALARDGSR AATTGASDML RSFRPGFQPN NQRPQTAWSA       360
     ETSPSQPYQP ATGFGERPQA SFDGLSMPTA RAEPQFSPQP AVAEPNTRYP LGAARAQIHA       420
     NYIVAQTEDG LVIVDQHAAH ERLVFEAMRK ALHSKRLASQ VLLIPEIVDI PEEDCDRLMQ       480
     HAAELSELGL AIERFGPGAI AVRETPAMLG EVDAHGLIRQ LADEIAEWDT ASGLSAKLEY       540
     VAATMACHGS VRSGRRLRPE EMNALLREME VTPGSGQCNH GRPTYIELKL SDIERLFGRS       600
//

If you have problems or comments...

PBIL Back to PBIL home page